PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr6g477860.1
Common NameMTR_6g477860
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 468aa    MW: 51600.6 Da    PI: 5.7389
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr6g477860.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.97.2e-1657101147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r +WT eE++++++a k++G g W+ I +++g  +t+ q++s+ qk+
  Medtr6g477860.1  57 REKWTDEEHQKFLEALKLYGRG-WRQIEEHIG-SKTAIQIRSHAQKF 101
                      789*******************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.5E-1651105IPR009057Homeodomain-like
PROSITE profilePS5129420.35852106IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-854104IPR009057Homeodomain-like
TIGRFAMsTIGR015575.2E-1655104IPR006447Myb domain, plants
SMARTSM007173.5E-1256104IPR001005SANT/Myb domain
PfamPF002496.6E-1357100IPR001005SANT/Myb domain
CDDcd001673.25E-1059102No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 468 aa     Download sequence    Send to blast
MENKDQVQGT KSTGTASKCH SKGGSQSEND AKSQDIPSVG NNLAPKVRKP YTITKQREKW  60
TDEEHQKFLE ALKLYGRGWR QIEEHIGSKT AIQIRSHAQK FFSKVVREPD GSAESPIQPI  120
DIPPPRPKRK PLHPYPRKSV DSFKGQLVPN ESETSPSINL SVAENDTQSP TSVLGSEAFG  180
SAAFSEQTNR CLSPNSCTTE IHPVSLSPVE KENDCQTSKP SEEEEKGSLA SIPSTDSKPL  240
MCMKSENISS EETQSSKEDA ANMPQITSIK LFGRTLSMGS QKSMKDDDEN TKLITIKSNE  300
MEDVEKVGQK EVSEPLDIQL SLGICTPDGA QVSSMERPKE SPYVSECATL PLWSLYQGLP  360
AFHLMPCNHQ ILNPVPLRPC LKVITREEES SCTGSNTESV CDMENQSKNN SSDTDDSQTQ  420
KHRQEGVVLK KSGRGFVPYK RCLAERDENS LIAGLEEREG QRARVCS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.156960.0leaf| root
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00146DAPTransfer from AT1G18330Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1480930.0BT148093.1 Medicago truncatula clone JCVI-FLMt-21K2 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013452818.10.0myb transcription factor
TrEMBLA0A072UBN00.0A0A072UBN0_MEDTR; Myb transcription factor
STRINGGLYMA16G34340.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF73133244
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18330.17e-48MYB_related family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]